View larger
Human CSF2RA (P15509, 20 a.a. - 320 a.a) partial-length recombinant protein with His-tag at C-terminal expressed in <i>Baculovir
AB-P8516
New product
CSF2RA (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 5 ug |
| Gene Name | CSF2RA |
| Gene Alias | CD116|CDw116|CSF2R|CSF2RAX|CSF2RAY|CSF2RX|CSF2RY|GM-CSF-R-alpha|GMCSFR|GMR|MGC3848|MGC4838 |
| Gene Description | colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | ADPLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLI |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | CSF2RA protein solution (0.5mg/mL) contains Phosphate Buffered Saline (pH 7.4) and 10% glycerol. |
| Gene ID | 1438 |
More info
Human CSF2RA (P15509, 20 a.a. - 320 a.a) partial-length recombinant protein with His-tag at C-terminal expressed in Baculovirus.