Clcf1 (Mouse) Recombinant Protein View larger

Mouse Clcf1 (P51642) recombinant protein expressed in <i>Escherichia coli</i>.

AB-P8509

New product

Clcf1 (Mouse) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 25 ug
Gene Name Clcf1
Gene Alias Bsf3|CLC|MGC129162|MGC129163
Gene Description cardiotrophin-like cytokine factor 1
Storage Conditions Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Immunogen Prot. Seq MAFAEQSPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNISLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLTLQVSAFAYQLEELMALLEQKVPEKEADGMPVTIGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHHMGISAHESHYGAKQM.
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized from a 0.2um filtered concentrated solution in PBS, pH 7.4.
Gene ID 56708

More info

Mouse Clcf1 (P51642) recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Mouse Clcf1 (P51642) recombinant protein expressed in <i>Escherichia coli</i>.

Mouse Clcf1 (P51642) recombinant protein expressed in <i>Escherichia coli</i>.