CLCF1 (Human) Recombinant Protein
  • CLCF1 (Human) Recombinant Protein

CLCF1 (Human) Recombinant Protein

Ref: AB-P8508
CLCF1 (Human) Recombinant Protein

Información del producto

Human CLCF1 (Q9UBD9, 1 a.a. - 200 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name CLCF1
Gene Alias BSF3|CISS2|CLC|NNT1|NR6
Gene Description cardiotrophin-like cytokine factor 1
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM.
Form Liquid
Antigen species Target species Human
Storage Buffer CNTF protein solution (1mg/mL) containing 20 mM Tris-HCl buffer (pH 8.5), 1 mM DTT,30% Glycerol and 0.2M NaCl.
Gene ID 23529

Enviar uma mensagem


CLCF1 (Human) Recombinant Protein

CLCF1 (Human) Recombinant Protein