Armetl1 (Rat) Recombinant Protein
  • Armetl1 (Rat) Recombinant Protein

Armetl1 (Rat) Recombinant Protein

Ref: AB-P8504
Armetl1 (Rat) Recombinant Protein

Información del producto

Rat Armetl1 (P0C5I0) recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Armetl1
Gene Alias -
Gene Description arginine-rich, mutated in early stage tumors-like 1
Storage Conditions Store, frozen at -20C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QGLEAGVRSRADCEVCKEFLNRFYNSLLTRGIDFSVDTIEEELISFCADTKGKENRLCYYLGATKDSATKILGEVTRPMSVHMPTVKICEKLKKMDSQICELKYEKKLDLESVDLWKMRVAELKQILHSWGEECRACAEKHDYVNLIKELAPKYVETRPQTEL.
Form Lyophilized
Antigen species Target species Rat
Storage Buffer CDNF protein was lyophilized from a 0.2um filtered concentrated solution in 1xPBS, pH 7.4.
Gene ID 361276

Enviar uma mensagem


Armetl1 (Rat) Recombinant Protein

Armetl1 (Rat) Recombinant Protein