ARMETL1 (Human) Recombinant Protein
  • ARMETL1 (Human) Recombinant Protein

ARMETL1 (Human) Recombinant Protein

Ref: AB-P8502
ARMETL1 (Human) Recombinant Protein

Información del producto

Human ARMETL1 (Q49AH0) recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name ARMETL1
Gene Alias cdnf
Gene Description arginine-rich, mutated in early stage tumors-like 1
Storage Conditions Store, frozen at -20C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL
Form Lyophilized
Antigen species Target species Human
Storage Buffer CDNF protein was lyophilized from a 0.2um filtered concentrated solution in 1xPBS, pH 7.4.
Gene ID 441549

Enviar uma mensagem


ARMETL1 (Human) Recombinant Protein

ARMETL1 (Human) Recombinant Protein