View larger
Human ARMETL1 (Q49AH0) recombinant protein expressed in <i>Escherichia coli</i>.
AB-P8502
New product
ARMETL1 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | ARMETL1 |
| Gene Alias | cdnf |
| Gene Description | arginine-rich, mutated in early stage tumors-like 1 |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | QEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | CDNF protein was lyophilized from a 0.2um filtered concentrated solution in 1xPBS, pH 7.4. |
| Gene ID | 441549 |
More info
Human ARMETL1 (Q49AH0) recombinant protein expressed in Escherichia coli.