View larger
Human BST1 (Q10588, 33 a.a. - 293a.a.) partial-length recombinant protein with His-tag at C-terminal expressed in <i>Baculovirus
AB-P8495
New product
BST1 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | BST1 |
| Gene Alias | CD157 |
| Gene Description | bone marrow stromal cell antigen 1 |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | RWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAA |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | BST1 protein solution (0.5mg/mL) contains 10% glycerol & Phosphate Buffered Saline (pH 7.4). |
| Gene ID | 683 |
More info
Human BST1 (Q10588, 33 a.a. - 293a.a.) partial-length recombinant protein with His-tag at C-terminal expressed in Baculovirus.