BST1 (Human) Recombinant Protein
  • BST1 (Human) Recombinant Protein

BST1 (Human) Recombinant Protein

Ref: AB-P8495
2 x 10 ug

Información del producto

BST1 (Human) Recombinant Protein
Información adicional
Size 2 x 10 ug
Gene Name BST1
Gene Alias CD157
Gene Description bone marrow stromal cell antigen 1
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq RWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAA
Form Liquid
Antigen species Target species Human
Storage Buffer BST1 protein solution (0.5mg/mL) contains 10% glycerol & Phosphate Buffered Saline (pH 7.4).
Gene ID 683

Enviar uma mensagem


BST1 (Human) Recombinant Protein

BST1 (Human) Recombinant Protein