NGF (Human) Recombinant Protein
  • NGF (Human) Recombinant Protein

NGF (Human) Recombinant Protein

Ref: AB-P8488
2 x 10 ug

Información del producto

NGF (Human) Recombinant Protein
Información adicional
Size 2 x 10 ug
Gene Name NGF
Gene Alias Beta-NGF|HSAN5|MGC161426|MGC161428|NGFB
Gene Description nerve growth factor (beta polypeptide)
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA.
Form Lyophilized
Antigen species Target species Human
Storage Buffer ProNGF was lyophilized from a 0.2 uM filtered solution of 20m Tris-HCL, 0.5M NaCl, 5% Trehalose, 5% Mannitol. 0.01% Tween-80 and 1mM EDTA pH-8.
Gene ID 4803

Enviar uma mensagem


NGF (Human) Recombinant Protein

NGF (Human) Recombinant Protein