View larger
Human NGF (P01138) recombinant protein expressed in <i>Escherichia coli</i>.
AB-P8488
New product
NGF (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | NGF |
| Gene Alias | Beta-NGF|HSAN5|MGC161426|MGC161428|NGFB |
| Gene Description | nerve growth factor (beta polypeptide) |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | MEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | ProNGF was lyophilized from a 0.2 uM filtered solution of 20m Tris-HCL, 0.5M NaCl, 5% Trehalose, 5% Mannitol. 0.01% Tween-80 and 1mM EDTA pH-8. |
| Gene ID | 4803 |
More info
Human NGF (P01138) recombinant protein expressed in Escherichia coli.