Ngf (Mouse) Recombinant Protein
  • Ngf (Mouse) Recombinant Protein

Ngf (Mouse) Recombinant Protein

Ref: AB-P8487
Ngf (Mouse) Recombinant Protein

Información del producto

Mouse Ngf (P01139) recombinant protein produced in Submaxillary Gland of Grown Mouse.
Información adicional
Size 20 ug
Gene Name Ngf
Gene Alias Ngfb
Gene Description nerve growth factor
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG.
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer The NGF beta Mouse was lyophilized from solution containing 5% mannitol and 1% HSA.
Gene ID 18049

Enviar uma mensagem


Ngf (Mouse) Recombinant Protein

Ngf (Mouse) Recombinant Protein