NGF (Human) Recombinant Protein
  • NGF (Human) Recombinant Protein

NGF (Human) Recombinant Protein

Ref: AB-P8483
NGF (Human) Recombinant Protein

Información del producto

Human NGF (P01138) recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name NGF
Gene Alias Beta-NGF|HSAN5|MGC161426|MGC161428|NGFB
Gene Description nerve growth factor (beta polypeptide)
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA.
Form Lyophilized
Antigen species Target species Human
Storage Buffer The beta-NGF protein was lyophilized from a 0.2um filtered solution containing 0.1% Trifluoroacetic Acid (TFA).
Gene ID 4803

Enviar uma mensagem


NGF (Human) Recombinant Protein

NGF (Human) Recombinant Protein