BMP5 (Human) Recombinant Protein
  • BMP5 (Human) Recombinant Protein

BMP5 (Human) Recombinant Protein

Ref: AB-P8475
20 ug

Información del producto

BMP5 (Human) Recombinant Protein
Información adicional
Size 20 ug
Gene Name BMP5
Gene Alias MGC34244
Gene Description bone morphogenetic protein 5
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MAANKRKNQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH.
Form Liquid
Antigen species Target species Human
Storage Buffer The BMP-5 solution contains 10mM Sodium Citrate buffer (pH3.5) and 10% Glycerol.
Gene ID 653

Enviar uma mensagem


BMP5 (Human) Recombinant Protein

BMP5 (Human) Recombinant Protein