View larger
Human BMP5 (P22003, 317 a.a. - 454 a.a.) partial-length recombinant protein expressed in <i>Escherichia coli</i>.
AB-P8475
New product
BMP5 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | BMP5 |
| Gene Alias | MGC34244 |
| Gene Description | bone morphogenetic protein 5 |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | MAANKRKNQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | The BMP-5 solution contains 10mM Sodium Citrate buffer (pH3.5) and 10% Glycerol. |
| Gene ID | 653 |
More info
Human BMP5 (P22003, 317 a.a. - 454 a.a.) partial-length recombinant protein expressed in Escherichia coli.