TNFRSF13C (Human) Recombinant Protein
  • TNFRSF13C (Human) Recombinant Protein

TNFRSF13C (Human) Recombinant Protein

Ref: AB-P8464
TNFRSF13C (Human) Recombinant Protein

Información del producto

Human TNFRSF13C (Q96RJ3) recombinant protein expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name TNFRSF13C
Gene Alias BAFF-R|BAFFR|CD268|MGC138235
Gene Description tumor necrosis factor receptor superfamily, member 13C
Storage Conditions Store, frozen at -20C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPG.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 20mM PB, pH 8.0, 500mM NaCl.
Gene ID 115650

Enviar uma mensagem


TNFRSF13C (Human) Recombinant Protein

TNFRSF13C (Human) Recombinant Protein