BDNF (Human) Recombinant Protein,homodimer
  • BDNF (Human) Recombinant Protein,homodimer

BDNF (Human) Recombinant Protein,homodimer

Ref: AB-P8457
BDNF (Human) Recombinant Protein,homodimer

Información del producto

Human BDNF (P23560) recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name BDNF
Gene Alias MGC34632
Gene Description brain-derived neurotrophic factor
Storage Conditions Store, frozen at -20C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized without additives.
Gene ID 627

Enviar uma mensagem


BDNF (Human) Recombinant Protein,homodimer

BDNF (Human) Recombinant Protein,homodimer