DEFB105A (Human) Recombinant Protein
  • DEFB105A (Human) Recombinant Protein

DEFB105A (Human) Recombinant Protein

Ref: AB-P8455
DEFB105A (Human) Recombinant Protein

Información del producto

Human DEFB105A (Q8NG35) recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name DEFB105A
Gene Alias BD-5|DEFB-5|DEFB105
Gene Description defensin, beta 105A
Storage Conditions Store, frozen at -20C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq GLDFSQPFPSGEFAVCESCKLGRGKCRKECLENEKPDGNCRLNFLCCRQRI.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS, pH 7.4.
Gene ID 245908

Enviar uma mensagem


DEFB105A (Human) Recombinant Protein

DEFB105A (Human) Recombinant Protein