DEFB4A (Human) Recombinant Protein
  • DEFB4A (Human) Recombinant Protein

DEFB4A (Human) Recombinant Protein

Ref: AB-P8448
20 ug

Información del producto

DEFB4A (Human) Recombinant Protein
Información adicional
Size 20 ug
Gene Name DEFB4
Gene Alias DEFB-2|DEFB102|DEFB2|HBD-2|SAP1
Gene Description defensin, beta 4
Storage Conditions Store, frozen at -20C for longer periods of time.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 20mM PB pH 7.4 and 130mM NaCl.
Gene ID 1673

Enviar uma mensagem


DEFB4A (Human) Recombinant Protein

DEFB4A (Human) Recombinant Protein