Tnfsf13 (Mouse) Recombinant Protein
  • Tnfsf13 (Mouse) Recombinant Protein

Tnfsf13 (Mouse) Recombinant Protein

Ref: AB-P8442
20 ug

Información del producto

Tnfsf13 (Mouse) Recombinant Protein
Información adicional
Size 20 ug
Gene Name Tnfsf13
Gene Alias 2310026N09Rik|APRIL|MGC106105|TALL2|TRDL1|Tnfsf12
Gene Description tumor necrosis factor (ligand) superfamily, member 13
Storage Conditions Store, frozen at -20C for longer periods of time.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AVLTQKHKKKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL.
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS, pH 7.4, with 0.02 % Tween-20.
Gene ID 69583

Enviar uma mensagem


Tnfsf13 (Mouse) Recombinant Protein

Tnfsf13 (Mouse) Recombinant Protein