View larger
Human TNFSF13 (O75888, 105 a.a. - 247 a.a.) partial-length recombinant protein with T7-tag at N-terminal expressed in <i>Escheri
AB-P8441
New product
TNFSF13 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | TNFSF13 |
| Gene Alias | APRIL|CD256|TALL2|TRDL-1|UNQ383/PRO715|ligand |
| Gene Description | tumor necrosis factor (ligand) superfamily, member 13 |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | MASMTGGQQMGRGSHMAVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGL. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | 20mM Tris-HCl buffer (pH 8.0), 0.4M UREA and 10% glycerol. |
| Gene ID | 8741 |
More info
Human TNFSF13 (O75888, 105 a.a. - 247 a.a.) partial-length recombinant protein with T7-tag at N-terminal expressed in Escherichia coli.