TNFSF13 (Human) Recombinant Protein
  • TNFSF13 (Human) Recombinant Protein

TNFSF13 (Human) Recombinant Protein

Ref: AB-P8441
20 ug

Información del producto

TNFSF13 (Human) Recombinant Protein
Información adicional
Size 20 ug
Gene Name TNFSF13
Gene Alias APRIL|CD256|TALL2|TRDL-1|UNQ383/PRO715|ligand
Gene Description tumor necrosis factor (ligand) superfamily, member 13
Storage Conditions Store, frozen at -20C for longer periods of time.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MASMTGGQQMGRGSHMAVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGL.
Form Liquid
Antigen species Target species Human
Storage Buffer 20mM Tris-HCl buffer (pH 8.0), 0.4M UREA and 10% glycerol.
Gene ID 8741

Enviar uma mensagem


TNFSF13 (Human) Recombinant Protein

TNFSF13 (Human) Recombinant Protein