APOM (Human) Recombinant Protein
  • APOM (Human) Recombinant Protein

APOM (Human) Recombinant Protein

Ref: AB-P8440
APOM (Human) Recombinant Protein

Información del producto

Human APOM (O95445) recombinant protein with FLAG-tag at C-terminal expressed in HEK293 cells.
Información adicional
Size 2 x 10 ug
Gene Name APOM
Gene Alias G3a|HSPC336|MGC22400|NG20
Gene Description apolipoprotein M
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq HVDYKDDDDKPAGCPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 20mM TRIS and 50mM NaCl, pH 7.5.
Gene ID 55937

Enviar uma mensagem


APOM (Human) Recombinant Protein

APOM (Human) Recombinant Protein