Clu (Mouse) Recombinant Protein View larger

Mouse Clu (Q06890, 22 a.a. - 448 a.a) partial-length recombinant protein with His-tag at C-terminal expressed in HEK293 cells.

AB-P8434

New product

Clu (Mouse) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 2 x 10 ug
Gene Name Clu
Gene Alias AI893575|ApoJ|Cli|D14Ucla3|SP-40|Sgp-2|Sgp2|Sugp-2
Gene Description clusterin
Storage Conditions Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Immunogen Prot. Seq EQEVSDNELQELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFARASGIIDTLFQDRFFARELHDPHYFSPIGFPHKRPHFLYPKSRLVRSLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLRE
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized from 20 mM Tris buffer and 50 mM NaCl, pH 7.5
Gene ID 12759

More info

Mouse Clu (Q06890, 22 a.a. - 448 a.a) partial-length recombinant protein with His-tag at C-terminal expressed in HEK293 cells.

Enviar uma mensagem

Mouse Clu (Q06890, 22 a.a. - 448 a.a) partial-length recombinant protein with His-tag at C-terminal expressed in HEK293 cells.

Mouse Clu (Q06890, 22 a.a. - 448 a.a) partial-length recombinant protein with His-tag at C-terminal expressed in HEK293 cells.