CLU (Human) Recombinant Protein
  • CLU (Human) Recombinant Protein

CLU (Human) Recombinant Protein

Ref: AB-P8433
CLU (Human) Recombinant Protein

Información del producto

Human CLU (P10909, 23 a.a. - 449 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name CLU
Gene Alias AAG4|APOJ|CLI|KUB1|MGC24903|SGP-2|SGP2|SP-40|TRPM-2|TRPM2
Gene Description clusterin
Storage Conditions Store, frozen at -20C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFH
Form Liquid
Antigen species Target species Human
Storage Buffer 20mM Tris-HCl buffer (pH 8.0), 0.15M NaCl, 10% glycerol and 1mM DTT
Gene ID 1191

Enviar uma mensagem


CLU (Human) Recombinant Protein

CLU (Human) Recombinant Protein