View larger
Human APOH (P02649, 20 a.a. - 345 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in <i>Escherichi
AB-P8429
New product
APOH (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | APOH |
| Gene Alias | B2G1|BG |
| Gene Description | apolipoprotein H (beta-2-glycoprotein I) |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSGRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKL |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | 20mM Tris-HCl buffer (pH 8.0), 2M urea and 10% glycerol |
| Gene ID | 350 |
More info
Human APOH (P02649, 20 a.a. - 345 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.