APOH (Human) Recombinant Protein
  • APOH (Human) Recombinant Protein

APOH (Human) Recombinant Protein

Ref: AB-P8429
APOH (Human) Recombinant Protein

Información del producto

Human APOH (P02649, 20 a.a. - 345 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name APOH
Gene Alias B2G1|BG
Gene Description apolipoprotein H (beta-2-glycoprotein I)
Storage Conditions Store, frozen at -20C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSGRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKL
Form Liquid
Antigen species Target species Human
Storage Buffer 20mM Tris-HCl buffer (pH 8.0), 2M urea and 10% glycerol
Gene ID 350

Enviar uma mensagem


APOH (Human) Recombinant Protein

APOH (Human) Recombinant Protein