View larger
Human ANGPTL3 (Q9Y5C1, 243 a.a. - 460 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in <i>Escher
AB-P8410
New product
ANGPTL3 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | ANGPTL3 |
| Gene Alias | ANGPT5 |
| Gene Description | angiopoietin-like 3 |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | 20mM Tris-HCl (pH8.0) and 10% glycerol. |
| Gene ID | 27329 |
More info
Human ANGPTL3 (Q9Y5C1, 243 a.a. - 460 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.