ANGPTL3 (Human) Recombinant Protein
  • ANGPTL3 (Human) Recombinant Protein

ANGPTL3 (Human) Recombinant Protein

Ref: AB-P8410
ANGPTL3 (Human) Recombinant Protein

Información del producto

Human ANGPTL3 (Q9Y5C1, 243 a.a. - 460 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name ANGPTL3
Gene Alias ANGPT5
Gene Description angiopoietin-like 3
Storage Conditions Store, frozen at -20C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE.
Form Liquid
Antigen species Target species Human
Storage Buffer 20mM Tris-HCl (pH8.0) and 10% glycerol.
Gene ID 27329

Enviar uma mensagem


ANGPTL3 (Human) Recombinant Protein

ANGPTL3 (Human) Recombinant Protein