ANGPTL3 (Human) Recombinant Protein
  • ANGPTL3 (Human) Recombinant Protein

ANGPTL3 (Human) Recombinant Protein

Ref: AB-P8409
ANGPTL3 (Human) Recombinant Protein

Información del producto

Human ANGPTL3 (Q9Y5C1, 17 a.a. - 460 a.a.) partial-length recombinant protein with His-tag at C-terminal expressed in HEK293 cell.
Información adicional
Size 2 x 10 ug
Gene Name ANGPTL3
Gene Alias ANGPT5
Gene Description angiopoietin-like 3
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFH
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 0.05M phosphate buffer and 0.075M NaCl, pH 7.4.
Gene ID 27329

Enviar uma mensagem


ANGPTL3 (Human) Recombinant Protein

ANGPTL3 (Human) Recombinant Protein