View larger
Human TNFRSF18 (Q9UNG2, 50 a.a. - 177 a.a.) partial-length recombinant protein with His-tag at C-terminal expressed in <i>Escher
AB-P8403
New product
TNFRSF18 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | TNFSF18 |
| Gene Alias | AITRL|GITRL|MGC138237|TL6|hGITRL |
| Gene Description | tumor necrosis factor (ligand) superfamily, member 18 |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | MQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILIANPQEISLEHHHHHH. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | 20mM Tris-HCl buffer (pH8.0) & 10% glycerol. |
| Gene ID | 8995 |
More info
Human TNFRSF18 (Q9UNG2, 50 a.a. - 177 a.a.) partial-length recombinant protein with His-tag at C-terminal expressed in Escherichia coli.