AIF1 (Human) Recombinant Protein
  • AIF1 (Human) Recombinant Protein

AIF1 (Human) Recombinant Protein

Ref: AB-P8399
AIF1 (Human) Recombinant Protein

Información del producto

Human AIF1 (P55008) recombinant protein with His-tag at N-terminal expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name AIF1
Gene Alias AIF-1|IBA1|IRT-1
Gene Description allograft inflammatory factor 1
Storage Conditions For long term, store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MKHHHHHHASQTRDLQGGKAF¬GLLKAQQEERLDE-INKQFLDDPKYSSDED¬LPSKLEGFKEKYMEF¬DLNGNGDIDIMSLKRMLEK-LGVPKTHLELKKLI¬GEVSSGSGETFSYP¬DFLRMMLGKRSAIL-KMILMYEEKAREKEK¬PTGPPAKKAISELP.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 20mM Tris buffer and 50mM NaCl pH-7.5.
Gene ID 199

Enviar uma mensagem


AIF1 (Human) Recombinant Protein

AIF1 (Human) Recombinant Protein