View larger
Mouse Adipoq (Q60994, 18 a.a. - 247 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in <i>Escheric
AB-P8392
New product
Adipoq (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 25 ug |
| Gene Name | Adipoq |
| Gene Alias | 30kDa|APN|Acdc|Acrp30|GBP28|adipo|apM1 |
| Gene Description | adiponectin, C1Q and collagen domain containing |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMEDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN. |
| Form | Liquid |
| Antigen species Target species | Mouse |
| Storage Buffer | 20mM Tris-HCl pH-8, 1mM DTT and 10% Glycerol. |
| Gene ID | 11450 |
More info
Mouse Adipoq (Q60994, 18 a.a. - 247 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.