ADIPOQ (Human) Recombinant Protein
  • ADIPOQ (Human) Recombinant Protein

ADIPOQ (Human) Recombinant Protein

Ref: AB-P8389
ADIPOQ (Human) Recombinant Protein

Información del producto

Human ADIPOQ (Q15848, 106 a.a. - 242 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Baculovirus.
Información adicional
Size 5 ug
Gene Name ADIPOQ
Gene Alias ACDC|ACRP30|ADPN|APM-1|APM1|GBP28|adiponectin
Gene Description adiponectin, C1Q and collagen domain containing
Storage Conditions Store, frozen at -20C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq ADPEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDHHHHHH.
Form Liquid
Antigen species Target species Human
Storage Buffer Phosphate Buffered Saline (pH 7.4) and 10% glycerol.
Gene ID 9370

Enviar uma mensagem


ADIPOQ (Human) Recombinant Protein

ADIPOQ (Human) Recombinant Protein