ADIPOQ (Human) Recombinant Protein
  • ADIPOQ (Human) Recombinant Protein

ADIPOQ (Human) Recombinant Protein

Ref: AB-P8386
ADIPOQ (Human) Recombinant Protein

Información del producto

Human ADIPOQ (Q15848) recombinant protein with FLAG-tag at C-terminal expressed in HEK293 cells.
Información adicional
Size 2 x 10 ug
Gene Name ADIPOQ
Gene Alias ACDC|ACRP30|ADPN|APM-1|APM1|GBP28|adiponectin
Gene Description adiponectin, C1Q and collagen domain containing
Storage Conditions For long term, store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHIVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTNDYKDDDDK.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 50mM phosphate Buffer, 75mM NaCl, pH 7.4.
Gene ID 9370

Enviar uma mensagem


ADIPOQ (Human) Recombinant Protein

ADIPOQ (Human) Recombinant Protein