ADIPOQ (Human) Recombinant Protein View larger

Human ADIPOQ (Q15848) recombinant protein with FLAG-tag at C-terminal expressed in HEK293 cells.

AB-P8386

New product

ADIPOQ (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 2 x 10 ug
Gene Name ADIPOQ
Gene Alias ACDC|ACRP30|ADPN|APM-1|APM1|GBP28|adiponectin
Gene Description adiponectin, C1Q and collagen domain containing
Storage Conditions For long term, store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Immunogen Prot. Seq ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHIVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTNDYKDDDDK.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 50mM phosphate Buffer, 75mM NaCl, pH 7.4.
Gene ID 9370

More info

Human ADIPOQ (Q15848) recombinant protein with FLAG-tag at C-terminal expressed in HEK293 cells.

Enviar uma mensagem

Human ADIPOQ (Q15848) recombinant protein with FLAG-tag at C-terminal expressed in HEK293 cells.

Human ADIPOQ (Q15848) recombinant protein with FLAG-tag at C-terminal expressed in HEK293 cells.