View larger
Human ACVRL1 (P37023) recombinant protein with His-tag at C-terminal expressed in <i>Baculovirus</i>.
AB-P8380
New product
ACVRL1 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | ACVRL1 |
| Gene Alias | ACVRLK1|ALK-1|ALK1|HHT|HHT2|ORW2|SKR3|TSR-I |
| Gene Description | activin A receptor type II-like 1 |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQHHHHHH. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Phosphate buffered saline (pH7.4) and 10% glycerol |
| Gene ID | 94 |
More info
Human ACVRL1 (P37023) recombinant protein with His-tag at C-terminal expressed in Baculovirus.