IL17F (Human) Recombinant Protein
  • IL17F (Human) Recombinant Protein

IL17F (Human) Recombinant Protein

Ref: AB-P8368
IL17F (Human) Recombinant Protein

Información del producto

Human IL17F (Q96PD4, 31 a.a. - 163 a.a.) partial recombinant protein with His-tag at C-terminus expressed in Sf9 cells.
Información adicional
Size 5 ug
Gene Name IL17F
Gene Alias IL-17F|ML-1|ML1
Gene Description interleukin 17F
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq ADPRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQHHHHHH
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (1mM DTT, 20% glycerol)
Gene ID 112744

Enviar uma mensagem


IL17F (Human) Recombinant Protein

IL17F (Human) Recombinant Protein