IL17F (Human) Recombinant Protein
  • IL17F (Human) Recombinant Protein

IL17F (Human) Recombinant Protein

Ref: AB-P8366
25 ug

Información del producto

IL17F (Human) Recombinant Protein
Información adicional
Size 25 ug
Gene Name IL17F
Gene Alias IL-17F|ML-1|ML1
Gene Description interleukin 17F
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is <
Gene ID 112744

Enviar uma mensagem


IL17F (Human) Recombinant Protein

IL17F (Human) Recombinant Protein