IL17D (Human) Recombinant Protein
  • IL17D (Human) Recombinant Protein

IL17D (Human) Recombinant Protein

Ref: AB-P8363
25 ug

Información del producto

IL17D (Human) Recombinant Protein
Información adicional
Size 25 ug
Gene Name IL17D
Gene Alias FLJ30846|IL-17D|IL-22|IL-27|IL27
Gene Description interleukin 17D
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq APRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNASCPAGGRPADRRFRPPTNLRSVSPWAYRISYDPARYPRYLPEAYCLCRGCLTGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVGCTCVPEPEKDADSINSSIDKQGAKLLLGPNDAPAGP
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 53342

Enviar uma mensagem


IL17D (Human) Recombinant Protein

IL17D (Human) Recombinant Protein