View larger
Human IL17A (Q16552, 24 a.a. - 155 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
AB-P8358
New product
IL17A (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | IL17A |
| Gene Alias | CTLA8|IL-17|IL-17A|IL17 |
| Gene Description | interleukin 17A |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAHHHHHH |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In 20mM PBS pH 7.4 (0.1mM PMSF, 1mM EDTA, 20% glycerol) |
| Gene ID | 3605 |
More info
Human IL17A (Q16552, 24 a.a. - 155 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.