IL16 (Rhesus Macaque) Recombinant Protein
  • IL16 (Rhesus Macaque) Recombinant Protein

IL16 (Rhesus Macaque) Recombinant Protein

Ref: AB-P8355
IL16 (Rhesus Macaque) Recombinant Protein

Información del producto

Rhesus Macaque IL16 (O62675, 510 a.a. - 630 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name LOC574100
Gene Alias IL-16
Gene Description IL-16 precursor
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SAASASAASDVSVESSAEATVYTVTLEKMSAGLGFSLEGGKGSLHGDKPLTINRIFKGAASEQSETIQPGDEILQLAGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQPKETTAAADS
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 574100

Enviar uma mensagem


IL16 (Rhesus Macaque) Recombinant Protein

IL16 (Rhesus Macaque) Recombinant Protein