IL15 (Human) Recombinant Protein View larger

Human IL15 (P40933, 48 a.a. - 162 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.

AB-P8346

New product

IL15 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 2 x 10 ug
Gene Name IL15
Gene Alias IL-15|MGC9721
Gene Description interleukin 15
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Form Lyophilized
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is &gt
Gene ID 3600

More info

Human IL15 (P40933, 48 a.a. - 162 a.a.) partial recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Human IL15 (P40933, 48 a.a. - 162 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.

Human IL15 (P40933, 48 a.a. - 162 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.