IL13RA1 (Human) Recombinant Protein
  • IL13RA1 (Human) Recombinant Protein

IL13RA1 (Human) Recombinant Protein

Ref: AB-P8343
IL13RA1 (Human) Recombinant Protein

Información del producto

Human IL13RA1 (P78552, 22 a.a. - 343 a.a.) partial recombinant protein with His tag at C-terminus expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name IL13RA1
Gene Alias CD213A1|IL-13Ra|NR4
Gene Description interleukin 13 receptor, alpha 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq GGGGAAPTETQPPVTNLSVSVENLCTVIWTWNPPEGASSNCSLWYFSHFGDKQDKKIAPETRRSIEVPLNERICLQVGSQCSTNESEKPSILVEKCISPPEGDPESAVTELQCIWHNLSYMKCSWLPGRNTSPDTNYTLYYWHRSLEKIHQCENIFREGQYFGCSFDLTKVKDSSFEQHSVQIMVKDNAGKIKPSFNIVPLTSRVKPDPPHIKNLSFHNDDLYVQWENPQNFISRCLFYEVEVNNSQTETHNVFY
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 3597

Enviar uma mensagem


IL13RA1 (Human) Recombinant Protein

IL13RA1 (Human) Recombinant Protein