IL12RB1 (Human) Recombinant Protein
  • IL12RB1 (Human) Recombinant Protein

IL12RB1 (Human) Recombinant Protein

Ref: AB-P8335
IL12RB1 (Human) Recombinant Protein

Información del producto

Human IL12RB1 (P42701, 24 a.a. - 545 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Información adicional
Size 2 x 10 ug
Gene Name IL12RB1
Gene Alias CD212|IL-12R-BETA1|IL12RB|MGC34454
Gene Description interleukin 12 receptor, beta 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGT
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (1mM EDTA, 0.1mM PMSF, 30% glycerol)
Gene ID 3594

Enviar uma mensagem


IL12RB1 (Human) Recombinant Protein

IL12RB1 (Human) Recombinant Protein