IL12A (Human) Recombinant Protein
  • IL12A (Human) Recombinant Protein

IL12A (Human) Recombinant Protein

Ref: AB-P8328
IL12A (Human) Recombinant Protein

Información del producto

Human IL12A (P29459, 23 a.a. - 219 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name IL12A
Gene Alias CLMF|IL-12A|NFSK|NKSF1|P35
Gene Description interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In 1x PBS (50% glycerol)
Gene ID 3592

Enviar uma mensagem


IL12A (Human) Recombinant Protein

IL12A (Human) Recombinant Protein