IL12 (Human) Recombinant Protein View larger

Human IL12 (P29459, 23 a.a. - 219 a.a., P29460, 23 a.a. - 328 a.a.) partial recombinant protein expressed in HEK293 cells.

AB-P8326

New product

IL12 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 2 x 10 ug
Gene Name IL12A
Gene Alias CLMF|IL-12A|NFSK|NKSF1|P35
Gene Description interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35)
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVK
Form Lyophilized
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer In PBS (0.1% endotoxin-free recombinant HAS)
Gene ID 3592|3593

More info

Human IL12 (P29459, 23 a.a. - 219 a.a., P29460, 23 a.a. - 328 a.a.) partial recombinant protein expressed in HEK293 cells.

Enviar uma mensagem

Human IL12 (P29459, 23 a.a. - 219 a.a., P29460, 23 a.a. - 328 a.a.) partial recombinant protein expressed in HEK293 cells.

Human IL12 (P29459, 23 a.a. - 219 a.a., P29460, 23 a.a. - 328 a.a.) partial recombinant protein expressed in HEK293 cells.