IL12 (Human) Recombinant Protein
  • IL12 (Human) Recombinant Protein

IL12 (Human) Recombinant Protein

Ref: AB-P8326
IL12 (Human) Recombinant Protein

Información del producto

Human IL12 (P29459, 23 a.a. - 219 a.a., P29460, 23 a.a. - 328 a.a.) partial recombinant protein expressed in HEK293 cells.
Información adicional
Size 2 x 10 ug
Gene Name IL12A
Gene Alias CLMF|IL-12A|NFSK|NKSF1|P35
Gene Description interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVK
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS (0.1% endotoxin-free recombinant HAS)
Gene ID 3592|3593

Enviar uma mensagem


IL12 (Human) Recombinant Protein

IL12 (Human) Recombinant Protein