IL10RB (Human) Recombinant Protein
  • IL10RB (Human) Recombinant Protein

IL10RB (Human) Recombinant Protein

Ref: AB-P8321
IL10RB (Human) Recombinant Protein

Información del producto

Human IL10RB (Q08334, 20 a.a. - 220 a.a.) partial recombinant protein with hlgG-His tag at C-terminus expressed in Sf9 cells.
Información adicional
Size 2 x 10 ug
Gene Name IL10RB
Gene Alias CDW210B|CRF2-4|CRFB4|D21S58|D21S66|IL-10R2
Gene Description interleukin 10 receptor, beta
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 3588

Enviar uma mensagem


IL10RB (Human) Recombinant Protein

IL10RB (Human) Recombinant Protein