IL10 (Human) Recombinant Protein
  • IL10 (Human) Recombinant Protein

IL10 (Human) Recombinant Protein

Ref: AB-P8315
IL10 (Human) Recombinant Protein

Información del producto

Human IL10 (P22301, 19 a.a. - 178 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name IL10
Gene Alias CSIF|IL-10|IL10A|MGC126450|MGC126451|TGIF
Gene Description interleukin 10
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMSPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM Tris-HCl buffer pH 8.0 (20% glycerol)
Gene ID 3586

Enviar uma mensagem


IL10 (Human) Recombinant Protein

IL10 (Human) Recombinant Protein