Il7 (Mouse) Recombinant Protein
  • Il7 (Mouse) Recombinant Protein

Il7 (Mouse) Recombinant Protein

Ref: AB-P8306
Il7 (Mouse) Recombinant Protein

Información del producto

Mouse Il7 (P10168, 26 a.a. - 154 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name Il7
Gene Alias A630026I06Rik|Il-7|MGC129342|hlb368
Gene Description interleukin 7
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 16196

Enviar uma mensagem


Il7 (Mouse) Recombinant Protein

Il7 (Mouse) Recombinant Protein