IL6 (Human) Recombinant Protein
  • IL6 (Human) Recombinant Protein

IL6 (Human) Recombinant Protein

Ref: AB-P8289
IL6 (Human) Recombinant Protein

Información del producto

Human IL6 (P05231, 30 a.a. - 212 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Información adicional
Size 2 x 10 ug
Gene Name IL6
Gene Alias BSF2|HGF|HSF|IFNB2|IL-6
Gene Description interleukin 6 (interferon, beta 2)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENN_x005F_x000D__x000D_LNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKV_x005F_x000D__x000D_LIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQMHHHHHH
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 3569

Enviar uma mensagem


IL6 (Human) Recombinant Protein

IL6 (Human) Recombinant Protein