IL6 (Human) Recombinant Protein View larger

Human IL6 (P05231, 30 a.a. - 212 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.

AB-P8289

New product

IL6 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 2 x 10 ug
Gene Name IL6
Gene Alias BSF2|HGF|HSF|IFNB2|IL-6
Gene Description interleukin 6 (interferon, beta 2)
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENN_x005F_x000D__x000D_LNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKV_x005F_x000D__x000D_LIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQMHHHHHH
Form Liquid
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 3569

More info

Human IL6 (P05231, 30 a.a. - 212 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.

Enviar uma mensagem

Human IL6 (P05231, 30 a.a. - 212 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.

Human IL6 (P05231, 30 a.a. - 212 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.