IL5RA (Human) Recombinant Protein
  • IL5RA (Human) Recombinant Protein

IL5RA (Human) Recombinant Protein

Ref: AB-P8285
IL5RA (Human) Recombinant Protein

Información del producto

Human IL5RA (Q01344, 21 a.a. - 342 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Información adicional
Size 5 ug
Gene Name IL5RA
Gene Alias CD125|CDw125|HSIL5R3|IL5R|MGC26560
Gene Description interleukin 5 receptor, alpha
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq ADPDLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRNVNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAELHAPPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTEECQEYSKDTLGRNIACWFPRTFILSKGRDWLAVLVNGSSKHSAIRPFDQLFALHAIDQINPPLNVTAEIEGTRLSIQWEKPVSAFPIHCFDY
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 3568

Enviar uma mensagem


IL5RA (Human) Recombinant Protein

IL5RA (Human) Recombinant Protein