Il5 (Mouse) Recombinant Protein
  • Il5 (Mouse) Recombinant Protein

Il5 (Mouse) Recombinant Protein

Ref: AB-P8281
Il5 (Mouse) Recombinant Protein

Información del producto

Mouse Il5 (P04401, 21 a.a. - 133 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Información adicional
Size 2 x 10 ug
Gene Name Il5
Gene Alias Il-5
Gene Description interleukin 5
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEGHHHHHH
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 16191

Enviar uma mensagem


Il5 (Mouse) Recombinant Protein

Il5 (Mouse) Recombinant Protein