View larger
Human IL3RA (P26951 , 20 a.a. - 305 a.a.) partial recombinant protein with His tag at C-teminus expressed in Sf9 cells.
AB-P8264
New product
IL3RA (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 5 ug |
| Gene Name | IL3RA |
| Gene Alias | CD123|IL3R|IL3RAY|IL3RX|IL3RY|MGC34174|hIL-3Ra |
| Gene Description | interleukin 3 receptor, alpha (low affinity) |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | ADLKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQ |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In PBS pH 7.4 (10% glycerol) |
| Gene ID | 3563 |
More info
Human IL3RA (P26951 , 20 a.a. - 305 a.a.) partial recombinant protein with His tag at C-teminus expressed in Sf9 cells.