IL3RA (Human) Recombinant Protein
  • IL3RA (Human) Recombinant Protein

IL3RA (Human) Recombinant Protein

Ref: AB-P8264
IL3RA (Human) Recombinant Protein

Información del producto

Human IL3RA (P26951 , 20 a.a. - 305 a.a.) partial recombinant protein with His tag at C-teminus expressed in Sf9 cells.
Información adicional
Size 5 ug
Gene Name IL3RA
Gene Alias CD123|IL3R|IL3RAY|IL3RX|IL3RY|MGC34174|hIL-3Ra
Gene Description interleukin 3 receptor, alpha (low affinity)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq ADLKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQ
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 3563

Enviar uma mensagem


IL3RA (Human) Recombinant Protein

IL3RA (Human) Recombinant Protein