Il3 (Mouse) Recombinant Protein
  • Il3 (Mouse) Recombinant Protein

Il3 (Mouse) Recombinant Protein

Ref: AB-P8260
Il3 (Mouse) Recombinant Protein

Información del producto

Mouse Il3 (P01586, 27 a.a. - 166 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Información adicional
Size 5 ug
Gene Name Il3
Gene Alias BPA|Csfmu|HCGF|Il-3|MCGF|PSF
Gene Description interleukin 3
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVECLEHHHHHH
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 16187

Enviar uma mensagem


Il3 (Mouse) Recombinant Protein

Il3 (Mouse) Recombinant Protein