IL2RG (Human) Recombinant Protein
  • IL2RG (Human) Recombinant Protein

IL2RG (Human) Recombinant Protein

Ref: AB-P8255
IL2RG (Human) Recombinant Protein

Información del producto

Human IL2RG (P31785, 23 a.a. - 262 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Información adicional
Size 2 x 10 ug
Gene Name IL2RG
Gene Alias CD132|IMD4|SCIDX|SCIDX1
Gene Description interleukin 2 receptor, gamma (severe combined immunodeficiency)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAHHHHHH
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4
Gene ID 3561

Enviar uma mensagem


IL2RG (Human) Recombinant Protein

IL2RG (Human) Recombinant Protein