IL1R2 (Human) Recombinant Protein
  • IL1R2 (Human) Recombinant Protein

IL1R2 (Human) Recombinant Protein

Ref: AB-P8241
IL1R2 (Human) Recombinant Protein

Información del producto

Human IL1R2 (P27930, 14 a.a. - 343 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Información adicional
Size 5 ug
Gene Name IL1R2
Gene Alias CD121b|IL1RB|MGC47725
Gene Description interleukin 1 receptor, type II
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq FTLQPAAHTGAARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWASVSPRINLTWHKNDSARTVPGEEETRMWAQDGALWLLPALQEDSGTYVCTTRNASYCDKMSIELRVFENTDAFLPFISYPQILTLSTSGVLVCPDLSEFTRDKTDVKIQWYKDSLLLDKDNEKFLSVRGTTHLL_x005F_x005F_x005F_x000D__x005F_x000D__x000D_VHDVALEDAGYYRCVLTFAHEGQQYNITRS
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 7850

Enviar uma mensagem


IL1R2 (Human) Recombinant Protein

IL1R2 (Human) Recombinant Protein