IL1R1 (Human) Recombinant Protein
  • IL1R1 (Human) Recombinant Protein

IL1R1 (Human) Recombinant Protein

Ref: AB-P8240
IL1R1 (Human) Recombinant Protein

Información del producto

Human IL1R1 (P14778, 21 a.a. - 336 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Información adicional
Size 2 x 10 ug
Gene Name IL1R1
Gene Alias CD121A|D2S1473|IL-1R-alpha|IL1R|IL1RA|P80
Gene Description interleukin 1 receptor, type I
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq DKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLG
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 3554

Enviar uma mensagem


IL1R1 (Human) Recombinant Protein

IL1R1 (Human) Recombinant Protein