IL1RL1 (Human) Recombinant Protein
  • IL1RL1 (Human) Recombinant Protein

IL1RL1 (Human) Recombinant Protein

Ref: AB-P8232
IL1RL1 (Human) Recombinant Protein

Información del producto

Human IL1RL1 (Q01638, 19 a.a. - 328 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Información adicional
Size 2 x 10 ug
Gene Name IL1RL1
Gene Alias DER4|FIT-1|MGC32623|ST2|ST2L|ST2V|T1
Gene Description interleukin 1 receptor-like 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQN
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 9173

Enviar uma mensagem


IL1RL1 (Human) Recombinant Protein

IL1RL1 (Human) Recombinant Protein